PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02199.1.p
Common NameEUGRSUZ_A02199, LOC104443818
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 758aa    MW: 81136 Da    PI: 7.2278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02199.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1383.6e-12258317160
                       XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                       e e+k+  r+++NRe+A+ sRqRKk ++eeLeekv ++ +   +L  +++    e  +l+
  Eucgr.A02199.1.p 258 EDEDKKKARLMRNRESAQLSRQRKKHYVEELEEKVRSMHSTIAELNGKISFFMAENVSLR 317
                       6799********************************999988888777776666665555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-15258322IPR004827Basic-leucine zipper domain
PfamPF001703.7E-10258319IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.99260320IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.9E-17262320No hitNo description
SuperFamilySSF579592.25E-12262320No hitNo description
CDDcd147041.96E-21263313No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 758 aa     Download sequence    Send to blast
MADPAVSDPP PPAASGPDPV VPADFDCLPI PPLDPLFFSE GADPDSSSIG GGAPQPFDSD  60
LAFDFGFGDN GDFEFTFDGL GDLYLPGEDE SFLIPSPAEN PEQINCESGS SGISGDRASA  120
DVAGYLNCPP AESGSYRSGD QRASPENLSN VPSPDCDVSC DRQFSGGPVS SQGSGNGGGS  180
GLSDDTNPPS PCSGSFERDV SSKLAADEKV KAEEEMSNAF LAKRKKVQDD TVSETRSIKY  240
RRSAEAAVSV NDSQCNDEDE DKKKARLMRN RESAQLSRQR KKHYVEELEE KVRSMHSTIA  300
ELNGKISFFM AENVSLRQQL GGGGMCPPPA PGMYPAPPMG HMAYPWVPCA PYVMKPQGSQ  360
VPLVPIPRLK PQQPVSASKA KKVETKKSEG KTKKVASVSF LGLLFFVLLF GGLVPMVNVR  420
FGGSGDTGAG RFNYLNDRYY YHHKGRVLAV NGHMNGTYYG TGRGSSGGTY STGCSRGCGG  480
RSDYKITRKD RESMPNMSEP LVASLYVPRN DKLVKIDGNL IIHSIMASEK AMASHASGET  540
ENDGITDPTT RQNLASALAL PEIARANSRT CGKPTERQRA LASGNGDPLK ERMKSKPADG  600
KLQQWFREGL AGPMLSSGLC TEVFRFDVAS AKGAIVPASP VGNVTTESRR NSTHAGKGRN  660
RRFLHNLPTR LAGSNFNVSE ERARRNSKTR DLPTNKSLSS MVVSVLVDPR EAGDGDVDGM  720
MPPKSVSRIF VVVLMDSIKY VTYSCVLPRA GPHLVTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1649661RNSTHAGKGRNRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02199.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055658.10.0PREDICTED: uncharacterized protein LOC104443818
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A059DHS80.0A0A059DHS8_EUCGR; Uncharacterized protein
STRINGVIT_08s0040g00870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-156bZIP family protein